PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G021900.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family TALE
Protein Properties Length: 601aa    MW: 64445 Da    PI: 10.5954
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G021900.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.11.5e-083343711954
                         HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         Fe   ++yps  ++  L++++gL+ +qV++WF N R +
  Brast02G021900.3.p 334 FEHflHPYPSDVDKHILSRQTGLSRSQVSNWFINARVR 371
                         554459******************************88 PP

2BELL84.11.7e-27192260472
                BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         elq+ k kL  +leeVd+rY++y+eq++ +++ Feavag  +a+ Yt+lA+++iSrhFr+L+d ++ q+
  Brast02G021900.3.p 192 ELQRLKDKLYIMLEEVDRRYRRYCEQMRGLAGGFEAVAGERAAAGYTALASRTISRHFRSLRDGVVAQL 260
                         89999*************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005748.6E-25127258IPR006563POX domain
PfamPF075264.0E-32151256IPR006563POX domain
PROSITE profilePS5007111.629312375IPR001356Homeobox domain
SMARTSM003891.6E-8315379IPR001356Homeobox domain
CDDcd000861.84E-11315376No hitNo description
SuperFamilySSF466898.98E-17316382IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-27318381IPR009057Homeodomain-like
PfamPF059202.2E-17332371IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 601 aa     Download sequence    Send to blast
MIRVSGSRTT YRLPTRRPRR RSCRPWTTGR LRSSTACRQA WSCSACTPPC RARRRLPPLL  60
TATDQGTPAS PPCASSSSSS SIRISRRRCP SRCNTTSSSS TRRCRHGWCT SRTRPRTGMA  120
RRGTFAAPGS CSRRSSCWKG SAASPWTPKP SAQRQQRSSS KKMPAGGGGE GSSSSSSCRA  180
PSAQIQAMDA LELQRLKDKL YIMLEEVDRR YRRYCEQMRG LAGGFEAVAG ERAAAGYTAL  240
ASRTISRHFR SLRDGVVAQL QAVRKALGEK DSSSSKSPGG MTRGDTPRLK VLDQCIRQHK  300
AMHQNGGLLM ETHPWRPQRG LPERAVTVLR AWLFEHFLHP YPSDVDKHIL SRQTGLSRSQ  360
VSNWFINARV RLWKPMVEEM YVEEMKDDGG AQGHEGQVVV DASAANNNPS SGSNQLVQGD  420
GGEQKPTRAQ LRHADADADI GVAAHGRHDA GSLASVVNVG RMGMESFADM DGHGHFGFDA  480
YDTADADAGP SAGFGGGGGV SLTLGLQQHD SRGDHGGVNI AFGAPGPAHG GYLFPGDHQQ  540
QMGMLHTSAG HGHHIQFGAG GGMADSSAGD ASNGAGHVDA QQYRWLSAAG SSSLLRDMTG  600
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5bng_A9e-17321379159Homeobox protein Meis2
5bng_B9e-17321379159Homeobox protein Meis2
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11520RRPRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014752259.10.0PREDICTED: homeobox protein BEL1 homolog
RefseqXP_010229286.10.0PREDICTED: homeobox protein BEL1 homolog
RefseqXP_003562164.10.0PREDICTED: homeobox protein BEL1 homolog
TrEMBLI1HAB90.0I1HAB9_BRADI; Uncharacterized protein
STRINGBRADI1G76940.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.22e-81BEL1-like homeodomain 2